PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009799760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 353aa    MW: 40179.2 Da    PI: 9.5494
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009799760.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF442.7e-14349450
                    -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    e++ n++ t+  R++ i  K  ELS+LCd++ + ii s++g+l++++
  XP_009799760.1  3 EENQNKKKTYQVRKECIKRKTMELSTLCDIKCCTIITSPQGELQTWP 49
                    67889999**************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006610.876148IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.36E-14370IPR002100Transcription factor, MADS-box
PfamPF003197.6E-10348IPR002100Transcription factor, MADS-box
SuperFamilySSF530985.31E-8152268IPR012337Ribonuclease H-like domain
CDDcd062225.91E-19156268No hitNo description
PfamPF134561.7E-13156269No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MAEENQNKKK TYQVRKECIK RKTMELSTLC DIKCCTIITS PQGELQTWPE NLDAVKQVLN  60
LYTKTLSPNK KANEELSEEE IDILTLVESK LDAVNNRIRY LENKNAGFVR KKVNVKFTTQ  120
QATEFSYLAA SHHKGKKRTF GNLHWNPPKA NLYKFNTDGA HSTTADRIGG IIRNSNVEWI  180
LSFSRTVPKG TSVSAELHVL LTGLKLVHEY NLQPLEVDAK EIVKILQINN ISFANMLKDC  240
RYLLNQLGNP VVQHAYKEQN RVANQLAKAG KYFATKYVPC VYATVPVFVK QVSEDDRKSL  300
LDSVPSKETF PILCRLGEKP DSDVALVLLR GFWGIGDWLD RVRHSFYVYG VVL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009799760.10.0PREDICTED: uncharacterized protein LOC104245789, partial
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37231639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26880.11e-09AGAMOUS-like 26